Loading...
Statistics
Advertisement

Biopam.org

Advertisement
Conversion Technology Metas Server
Biopam.org is hosted in United States / San Francisco . Biopam.org uses HTTPS protocol. Number of used technologies: 9. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Biopam.org

Technology

Number of occurences: 9
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • SVG

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • form.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Biopam.org

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 324124620245871911870919948029394102254875
    • validFrom: 160815100500Z
    • validTo: 161113100500Z
    • validFrom_time_t: 1471255500
    • validTo_time_t: 1479031500
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 49:7D:8D:4E:E7:CD:8E:0F:59:D3:92:0F:A7:4B:4F:E1:D0:0E:3B:84
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:bioneuroemocionsiguenza.com, DNS:bionicbaylee.com, DNS:bionicfingerfilms.com, DNS:bioniclady.com, DNS:bionicmamas.com, DNS:bionico.org, DNS:bionictempo.com, DNS:bionictumbleweed.com, DNS:bionicun.com, DNS:bionicwomanchronicles.com, DNS:bioninmarrakech.org, DNS:bionomicpest.com, DNS:biopam.org, DNS:biopapo.com, DNS:biopartitioning2015.com, DNS:biopatentpulse.com, DNS:biopek.com, DNS:bioperipatetic.com, DNS:biopharmadeveloper.com, DNS:biopharmaehsforum.com, DNS:biophiliaportugal.org, DNS:biopinionated.com, DNS:bioplantimport.com, DNS:bioplasticsblog.com, DNS:tls.automattic.com, DNS:www.bioneuroemocionenmallorca.com, DNS:www.bioneuroemocionsiguenza.com, DNS:www.bionicbaylee.com, DNS:www.bionicfingerfilms.com, DNS:www.bioniclady.com, DNS:www.bionicmamas.com, DNS:www.bionico.org, DNS:www.bionictempo.com, DNS:www.bionictumbleweed.com, DNS:www.bionicun.com, DNS:www.bionicwomanchronicles.com, DNS:www.bioninmarrakech.org, DNS:www.bionomicpest.com, DNS:www.biopam.org, DNS:www.biopapo.com, DNS:www.biopartitioning2015.com, DNS:www.biopatentpulse.com, DNS:www.biopek.com, DNS:www.bioperipatetic.com, DNS:www.biopharmadeveloper.com, DNS:www.biopharmaehsforum.com, DNS:www.biophiliaportugal.org, DNS:www.biopinionated.com, DNS:www.bioplantimport.com, DNS:www.bioplasticsblog.com, DNS:www.bioplasticsnews.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Biopam.org

Number of occurences: 11
  • Name:
    Content: https://www.facebook.com/WordPresscom
  • Name: viewport
    Content: width=device-width
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: twitter:card
    Content: summary
  • Name: twitter:description
    Content: Visit the post for more.
  • Name: application-name
    Content: WordPress.com
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: HAYAT AÄžACI | on WordPress.com
  • Name: description
    Content:   Altay Türklerinin inançlarına göre gökyüzüne doğru çok büyük bir çam ağacı yükseliyordu. Gökleri delip çıkan bu ağacın tepesinde ise Tanrı Bay-Ülgen otururdu. Şaman davullarında görülen hayat ağacı motifinde ise bu ağacın kökleri dünyada değil, göğün başladığı yerden itibaren yükseliyordu. Dokuz tane dalı olan bu ağaç genellikle gökteki bir dağ veya tepe üzerine oturtulurdu. Ağacın…

Server / Hosting

  • IP: 192.0.78.25
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns2.wordpress.com
  • ns3.wordpress.com
  • ns1.wordpress.com
  • smtp-fwd.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Sat, 10 Sep 2016 12:29:31 GMT Content-Type: text/html Content-Length: 178 Location: https://www.biopam.org/ X-ac: 3.dfw _dfw X-Cache: MISS from s_mf40 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 301 Moved Permanently Server: nginx Date: Sat, 10 Sep 2016 12:29:32 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Strict-Transport-Security: max-age=86400 Location: https://biopam.org/ X-ac: 3.dfw _dfw HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Sat, 10 Sep 2016 12:29:33 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. X-Pingback: https://biopam.org/xmlrpc.php Link: ; rel=shortlink X-ac: 3.dfw _dfw

DNS

host: biopam.org
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: biopam.org
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: biopam.org
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: biopam.org
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: biopam.org
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: biopam.org
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300
host: biopam.org
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 10
  5. target: smtp-fwd.wordpress.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.iopam.org, www.bqiopam.org, www.qiopam.org, www.bwiopam.org, www.wiopam.org, www.bziopam.org, www.ziopam.org, www.bxiopam.org, www.xiopam.org, www.biopam.org, www.iopam.org, www.bsiopam.org, www.siopam.org, www.byiopam.org, www.yiopam.org, www.beiopam.org, www.eiopam.org, www.bdiopam.org, www.diopam.org, www.bciopam.org, www.ciopam.org, www.bopam.org, www.biropam.org, www.bropam.org, www.bifopam.org, www.bfopam.org, www.bivopam.org, www.bvopam.org, www.bikopam.org, www.bkopam.org, www.bi,opam.org, www.b,opam.org, www.bibopam.org, www.bbopam.org, www.bigopam.org, www.bgopam.org, www.bitopam.org, www.btopam.org, www.biyopam.org, www.byopam.org, www.biuopam.org, www.buopam.org, www.bijopam.org, www.bjopam.org, www.bimopam.org, www.bmopam.org, www.binopam.org, www.bnopam.org, www.bipam.org, www.biobpam.org, www.bibpam.org, www.biohpam.org, www.bihpam.org, www.biogpam.org, www.bigpam.org, www.biojpam.org, www.bijpam.org, www.biompam.org, www.bimpam.org, www.bio pam.org, www.bi pam.org, www.biovpam.org, www.bivpam.org, www.bioam.org, www.biopiam.org, www.bioiam.org, www.biopkam.org, www.biokam.org, www.biopuam.org, www.biouam.org, www.biopjam.org, www.biojam.org, www.bioplam.org, www.biolam.org, www.biopm.org, www.biopaom.org, www.biopom.org, www.biopapm.org, www.bioppm.org, www.biopa9m.org, www.biop9m.org, www.biopam.org, www.biopm.org, www.biopaim.org, www.biopim.org, www.biopaum.org, www.biopum.org, www.biopa.org, www.biopamp.org, www.biopap.org, www.biopamo.org, www.biopao.org, www.biopami.org, www.biopai.org, www.biopamk.org, www.biopak.org, www.biopam..org, www.biopa..org, www.biopamu.org, www.biopau.org, www.biopamj.org, www.biopaj.org, www.biopamn.org, www.biopan.org, www.biopam-.org, www.biopa-.org,

Other websites we recently analyzed

  1. Sandvig Studio | Art | Furniture |
    Dallas (United States) - 192.155.192.185
    Server software: Apache
    Technology: CSS, Font Awesome, Html, Iframe, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress
    Number of Javascript: 18
    Number of meta tags: 5
  2. Tax Forms
    Columbus (United States) - 50.6.15.187
    Server software: Apache
    Technology: Google Adsense, Html
    Number of Javascript: 1
    Number of meta tags: 1
  3. 기업건설정보
    디스크립션
    Korea, Republic of - 112.175.85.143
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript, jQuery, jQuery UI, Php
    Number of Javascript: 6
    Number of meta tags: 3
  4. ifashion
    ifashion
    Lithuania - 79.98.25.28
    G Analytics ID: UA-53267986-1
    Server software: Apache
    Technology: Carousel, CSS, Html, Html5, Javascript, jQuery Colorbox, jQuery Cookie, jQuery UI, Php, Google Analytics
    Number of Javascript: 11
    Number of meta tags: 4
  5. Home - ATER Viterbo
    Azienda Territoriale per l’Edilizia Residenziale Pubblica della Provincia di Viterbo
    Arezzo (Italy) - 62.149.142.90
    Server software: Apache
    Technology: CSS, Html, Iframe, Javascript, jQuery, Php, Joomla
    Number of Javascript: 7
    Number of meta tags: 4
  6. tuckerbicycle
    Check out this GoDaddy hosted webpage! http://tuckerbicycle.com.
    Scottsdale (United States) - 97.74.42.79
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, jQuery, jQuery UI
    Number of Javascript: 4
    Number of meta tags: 3
  7. Lehigh Cottage
    Scottsdale (United States) - 97.74.141.128
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery
    Number of Javascript: 4
    Number of meta tags: 4
  8. MK MEDIA - Интернет-маркетинг
    MK MEDIA - Интернет-маркетинг
    Russian Federation - 77.222.56.94
    Server software: nginx/1.9.12
    Technology: CSS, Html, Html5, Javascript, LiveInternet counter
    Number of Javascript: 1
    Number of meta tags: 4
  9. Welcome to COLORADOSPRINGSCRIMINALDEFENSELAWYER.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 2
  10. Home
    Brea (United States) - 69.163.144.16
    Server software: Apache
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 6
    Number of meta tags: 2

Check Other Websites